Lineage for d1kell1 (1kel L:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653251Domain d1kell1: 1kel L:1-112 [20112]
    Other proteins in same PDB: d1kelh1, d1kelh2, d1kell2
    part of Fab 28B4
    complexed with aah

Details for d1kell1

PDB Entry: 1kel (more details), 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)
PDB Compounds: (L:) 28b4 fab

SCOP Domain Sequences for d1kell1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kell1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik

SCOP Domain Coordinates for d1kell1:

Click to download the PDB-style file with coordinates for d1kell1.
(The format of our PDB-style files is described here.)

Timeline for d1kell1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kell2