Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab 28B4 (mouse), kappa L chain [48819] (2 PDB entries) |
Domain d1kell1: 1kel L:1-112 [20112] Other proteins in same PDB: d1kelh2, d1kell2 |
PDB Entry: 1kel (more details), 1.9 Å
SCOP Domain Sequences for d1kell1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kell1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 28B4 (mouse), kappa L chain} dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik
Timeline for d1kell1: