Lineage for d1kell1 (1kel L:1-112)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52053Species Fab 28B4 (mouse), kappa L chain [48819] (2 PDB entries)
  8. 52055Domain d1kell1: 1kel L:1-112 [20112]
    Other proteins in same PDB: d1kelh2, d1kell2

Details for d1kell1

PDB Entry: 1kel (more details), 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)
PDB Compounds: (L:)

SCOP Domain Sequences for d1kell1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kell1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 28B4 (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik

SCOP Domain Coordinates for d1kell1:

Click to download the PDB-style file with coordinates for d1kell1.
(The format of our PDB-style files is described here.)

Timeline for d1kell1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kell2