Lineage for d3ut5b2 (3ut5 B:246-442)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566578Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries)
  8. 2566610Domain d3ut5b2: 3ut5 B:246-442 [201114]
    Other proteins in same PDB: d3ut5a1, d3ut5b1, d3ut5c1, d3ut5d1, d3ut5e1, d3ut5e2
    automated match to d1z2bb2
    complexed with gdp, gtp, loc, mg, so4

Details for d3ut5b2

PDB Entry: 3ut5 (more details), 2.73 Å

PDB Description: Tubulin-Colchicine-Ustiloxin: Stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3ut5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ut5b2 d.79.2.1 (B:246-442) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatade

SCOPe Domain Coordinates for d3ut5b2:

Click to download the PDB-style file with coordinates for d3ut5b2.
(The format of our PDB-style files is described here.)

Timeline for d3ut5b2: