SCOP 1.55: Domain d1nldh1: 1nld H:1-112

Lineage for d1nldh1 (1nld H:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 1583, against an epitope of gp41 of HIV-1, (mouse), kappa L chain [48818] (1 PDB entry)

8. Domain d1nldh1: 1nld H:1-112 [20111]
   Other proteins in same PDB: d1nldh2, d1nldl2

Details for d1nldh1

PDB Entry: 1nld, 2.9 Å

PDB Description: fab fragment of a neutralizing antibody directed against an epitope of gp41 from hiv-1

SCOP Domain Sequences for d1nldh1:

Sequence; same for both SEQRES and ATOM records:

>d1nldh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 1583, against an epitope of gp41 of HIV-1, (mouse), kappa L chain}
qvklqqsgpglvqpsqslsitctvsgfsltcygvhwvrqspgkglewlgviwsggdtdyn
aafisrlsitkdnsksqvffkmnslqpndraiyycarrggdfwgqgttvtvs

Timeline for d1nldh1:

• d1nldh1 appears in SCOP 1.57
  
• d1nldh1 appears in the current release, SCOPe 2.08