Lineage for d3usel_ (3use L:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453554Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 1453555Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 1453642Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 1453643Protein automated matches [191173] (4 species)
    not a true protein
  7. 1453649Species Escherichia coli [TaxId:562] [195685] (3 PDB entries)
  8. 1453652Domain d3usel_: 3use L: [201106]
    automated match to d3uscl_
    complexed with 3ni, cl, f3s, f4s, fco, gol, li, lmt, mg, sf3, sf4, so4

Details for d3usel_

PDB Entry: 3use (more details), 1.67 Å

PDB Description: Crystal Structure of E. coli hydrogenase-1 in its as-isolated form
PDB Compounds: (L:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d3usel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3usel_ e.18.1.0 (L:) automated matches {Escherichia coli [TaxId: 562]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d3usel_:

Click to download the PDB-style file with coordinates for d3usel_.
(The format of our PDB-style files is described here.)

Timeline for d3usel_: