Lineage for d3uqdd_ (3uqd D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2154413Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2154414Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2154683Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2154684Protein automated matches [190117] (40 species)
    not a true protein
  7. 2154772Species Escherichia coli [TaxId:562] [188596] (4 PDB entries)
  8. 2154781Domain d3uqdd_: 3uqd D: [201104]
    automated match to d3cqda_
    complexed with adp, atp, f6p, fbp, mg

Details for d3uqdd_

PDB Entry: 3uqd (more details), 2.14 Å

PDB Description: crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products
PDB Compounds: (D:) 6-phosphofructokinase isozyme 2

SCOPe Domain Sequences for d3uqdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uqdd_ c.72.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
qkiyaylsr

SCOPe Domain Coordinates for d3uqdd_:

Click to download the PDB-style file with coordinates for d3uqdd_.
(The format of our PDB-style files is described here.)

Timeline for d3uqdd_: