Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (40 species) not a true protein |
Species Escherichia coli [TaxId:562] [188596] (4 PDB entries) |
Domain d3uqdc_: 3uqd C: [201103] automated match to d3cqda_ complexed with adp, atp, f6p, fbp, mg |
PDB Entry: 3uqd (more details), 2.14 Å
SCOPe Domain Sequences for d3uqdc_:
Sequence, based on SEQRES records: (download)
>d3uqdc_ c.72.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} vriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifpa ggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrql eeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaigni elvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciqv vpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddtq kiyaylsr
>d3uqdc_ c.72.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} vriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifpa ggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrql eeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaigni elvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciqv vpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlngtrlcshddtqk iyaylsr
Timeline for d3uqdc_: