Lineage for d3uoiq_ (3uoi Q:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317624Species Mycobacterium tuberculosis [TaxId:1773] [193333] (3 PDB entries)
  8. 2317641Domain d3uoiq_: 3uoi Q: [201090]
    automated match to d3uoiw_
    complexed with hem

Details for d3uoiq_

PDB Entry: 3uoi (more details), 1.9 Å

PDB Description: Mycobacterium tuberculosis bacterioferritin, BfrA
PDB Compounds: (Q:) bacterioferritin

SCOPe Domain Sequences for d3uoiq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uoiq_ a.25.1.0 (Q:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
ekivadeeehidyletqlelmdklgeelysaqcvsrppt

SCOPe Domain Coordinates for d3uoiq_:

Click to download the PDB-style file with coordinates for d3uoiq_.
(The format of our PDB-style files is described here.)

Timeline for d3uoiq_: