SCOPe 2.08: Domain d1dvfd1: 1dvf D:9-112

Lineage for d1dvfd1 (1dvf D:9-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d1dvfd1: 1dvf D:9-112 [20107]
   Other proteins in same PDB: d1dvfa_, d1dvfc_, d1dvfd2
   part of Fv E5.2, anti-idiotopic antibody to D1.3
   CASP1
   complexed with zn

Details for d1dvfd1

PDB Entry: 1dvf, 1.9 Å

PDB Description: idiotopic antibody d1.3 fv fragment-antiidiotopic antibody e5.2 fv fragment complex

PDB Compounds: (D:) fv e5.2

SCOPe Domain Sequences for d1dvfd1:

Sequence; same for both SEQRES and ATOM records:

>d1dvfd1 b.1.1.1 (D:9-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
telvksgasvklsctasgfnikdthmnwvkqrpeqglewigridpangniqydpkfrgka
titadtssntaylqlssltsedtavyycatkviyyqgrgamdywgqgttltvs

Timeline for d1dvfd1:

• d1dvfd1 first appeared (with stable ids) in SCOP 1.55, called d1dvfd_
  
• d1dvfd1 appears in SCOPe 2.07