Lineage for d1dvfd1 (1dvf D:9-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2344816Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2345282Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2345285Domain d1dvfd1: 1dvf D:9-112 [20107]
    Other proteins in same PDB: d1dvfa_, d1dvfc_, d1dvfd2
    part of Fv E5.2, anti-idiotopic antibody to D1.3
    CASP1
    complexed with zn

Details for d1dvfd1

PDB Entry: 1dvf (more details), 1.9 Å

PDB Description: idiotopic antibody d1.3 fv fragment-antiidiotopic antibody e5.2 fv fragment complex
PDB Compounds: (D:) fv e5.2

SCOPe Domain Sequences for d1dvfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvfd1 b.1.1.1 (D:9-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
telvksgasvklsctasgfnikdthmnwvkqrpeqglewigridpangniqydpkfrgka
titadtssntaylqlssltsedtavyycatkviyyqgrgamdywgqgttltvs

SCOPe Domain Coordinates for d1dvfd1:

Click to download the PDB-style file with coordinates for d1dvfd1.
(The format of our PDB-style files is described here.)

Timeline for d1dvfd1: