Lineage for d3unfq_ (3unf Q:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937493Species Mouse (Mus musculus) [TaxId:10090] [195930] (2 PDB entries)
  8. 1937499Domain d3unfq_: 3unf Q: [201066]
    Other proteins in same PDB: d3unfa_, d3unfd_, d3unff_, d3unfg_, d3unfh_, d3unfi_, d3unfj_, d3unfk_, d3unfl_, d3unfm_, d3unfo_, d3unfr_, d3unft_, d3unfu_, d3unfv_, d3unfw_, d3unfx_, d3unfy_, d3unfz_
    automated match to d1g0ue_
    complexed with 04c, cl, iod, k

Details for d3unfq_

PDB Entry: 3unf (more details), 2.9 Å

PDB Description: Mouse 20S immunoproteasome in complex with PR-957
PDB Compounds: (Q:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d3unfq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unfq_ d.153.1.0 (Q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgkdivvlgvekksvaklqdertvrk
icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytddai
etddltiklvikallevvqsggknielavmrrdqplkilnpeeiekyvaeiekekeen

SCOPe Domain Coordinates for d3unfq_:

Click to download the PDB-style file with coordinates for d3unfq_.
(The format of our PDB-style files is described here.)

Timeline for d3unfq_: