Lineage for d3unfg_ (3unf G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1437897Protein Proteasome alpha subunit (non-catalytic) [56255] (6 species)
    contains an extension to the common fold at the N-terminus
  7. 1438263Species Mouse (Mus musculus) [TaxId:10090] [195927] (2 PDB entries)
  8. 1438264Domain d3unfg_: 3unf G: [201056]
    Other proteins in same PDB: d3unfa_, d3unfb_, d3unfc_, d3unfd_, d3unfe_, d3unff_, d3unfh_, d3unfi_, d3unfj_, d3unfk_, d3unfl_, d3unfm_, d3unfn_, d3unfo_, d3unfp_, d3unfq_, d3unfr_, d3unfs_, d3unft_, d3unfv_, d3unfw_, d3unfx_, d3unfy_, d3unfz_
    automated match to d3unbu_
    complexed with 04c, cl, iod, k

Details for d3unfg_

PDB Entry: 3unf (more details), 2.9 Å

PDB Description: Mouse 20S immunoproteasome in complex with PR-957
PDB Compounds: (G:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d3unfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unfg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Mouse (Mus musculus) [TaxId: 10090]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
lae

SCOPe Domain Coordinates for d3unfg_:

Click to download the PDB-style file with coordinates for d3unfg_.
(The format of our PDB-style files is described here.)

Timeline for d3unfg_: