Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (9 species) not a true protein |
Domain d3unfc_: 3unf C: [201052] Other proteins in same PDB: d3unfa_, d3unfd_, d3unff_, d3unfg_, d3unfh_, d3unfi_, d3unfj_, d3unfk_, d3unfl_, d3unfm_, d3unfo_, d3unfr_, d3unft_, d3unfu_, d3unfv_, d3unfw_, d3unfx_, d3unfy_, d3unfz_ automated match to d1g0ue_ complexed with 04c, cl, iod, k |
PDB Entry: 3unf (more details), 2.9 Å
SCOPe Domain Sequences for d3unfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unfc_ d.153.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sydraitvfspdghlfqveyaqeavkkgstavgvrgkdivvlgvekksvaklqdertvrk icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytddai etddltiklvikallevvqsggknielavmrrdqplkilnpeeiekyvaeiekekeen
Timeline for d3unfc_: