Lineage for d3unbl_ (3unb L:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [195917] (2 PDB entries)
  8. 1678693Domain d3unbl_: 3unb L: [201045]
    Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
    automated match to d3unbz_
    complexed with 04c

Details for d3unbl_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (L:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d3unbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbl_ d.153.1.4 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rfspyafnggtvlaiagedfsivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvpltldramrlvkdvfi
saaerdvytgdalricivtkegireetvplrkd

SCOPe Domain Coordinates for d3unbl_:

Click to download the PDB-style file with coordinates for d3unbl_.
(The format of our PDB-style files is described here.)

Timeline for d3unbl_: