Lineage for d3unbj_ (3unb J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936958Species Mouse (Mus musculus) [TaxId:10090] [195917] (2 PDB entries)
  8. 1936987Domain d3unbj_: 3unb J: [201043]
    Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
    automated match to d3unbx_
    complexed with 04c

Details for d3unbj_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (J:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d3unbj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbj_ d.153.1.4 (J:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
rvidkdgihnleniaf

SCOPe Domain Coordinates for d3unbj_:

Click to download the PDB-style file with coordinates for d3unbj_.
(The format of our PDB-style files is described here.)

Timeline for d3unbj_: