SCOP 1.65: Domain d1clzl1: 1clz L:1-108

Lineage for d1clzl1 (1clz L:1-108)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d1clzl1: 1clz L:1-108 [20104]
   Other proteins in same PDB: d1clzh1, d1clzh2, d1clzl2
   part of Fab MBR96
   complexed with fuc, gal, nag, non

Details for d1clzl1

PDB Entry: 1clz, 2.8 Å

PDB Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clzl1:

Sequence; same for both SEQRES and ATOM records:

>d1clzl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

Timeline for d1clzl1:

• d1clzl1 first appeared (with stable ids) in SCOP 1.55
  
• d1clzl1 appears in SCOP 1.63
  
• d1clzl1 appears in SCOP 1.67
  
• d1clzl1 appears in the current release, SCOPe 2.08