SCOP 1.63: Domain d1clyh1: 1cly H:1-113

Lineage for d1clyh1 (1cly H:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab CBR96 (mouse/human), kappa L chain [48814] (2 PDB entries)

8. Domain d1clyh1: 1cly H:1-113 [20103]
   Other proteins in same PDB: d1clyh2, d1clyl2
   complexed with fuc, gal, nag, non

Details for d1clyh1

PDB Entry: 1cly, 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyh1:

Sequence; same for both SEQRES and ATOM records:

>d1clyh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsv

Timeline for d1clyh1:

• d1clyh1 first appeared (with stable ids) in SCOP 1.55
  
• d1clyh1 appears in SCOP 1.61
  
• d1clyh1 appears in SCOP 1.65
  
• d1clyh1 appears in the current release, SCOPe 2.08