Lineage for d3un8s_ (3un8 S:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2224977Domain d3un8s_: 3un8 S: [201027]
    Other proteins in same PDB: d3un8a_, d3un8b_, d3un8c_, d3un8d_, d3un8f_, d3un8g_, d3un8h_, d3un8i_, d3un8j_, d3un8k_, d3un8l_, d3un8m_, d3un8n_, d3un8o_, d3un8p_, d3un8q_, d3un8r_, d3un8t_, d3un8u_, d3un8v_, d3un8w_, d3un8x_, d3un8y_, d3un8z_
    automated match to d2zcye_
    complexed with 049

Details for d3un8s_

PDB Entry: 3un8 (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with PR-957 (epoxide)
PDB Compounds: (S:) Proteasome component PRE5

SCOPe Domain Sequences for d3un8s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3un8s_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d3un8s_:

Click to download the PDB-style file with coordinates for d3un8s_.
(The format of our PDB-style files is described here.)

Timeline for d3un8s_: