SCOP 1.55: Domain d1clyl1: 1cly L:3-108

Lineage for d1clyl1 (1cly L:3-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab CBR96 (mouse/human), kappa L chain [48814] (2 PDB entries)

8. Domain d1clyl1: 1cly L:3-108 [20102]
   Other proteins in same PDB: d1clyh2, d1clyl2

Details for d1clyl1

PDB Entry: 1cly, 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyl1:

Sequence; same for both SEQRES and ATOM records:

>d1clyl1 b.1.1.1 (L:3-108) Immunoglobulin (variable domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
lmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsg
vpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

Timeline for d1clyl1:

• d1clyl1 appears in SCOP 1.57
  
• d1clyl1 appears in the current release, SCOPe 2.08