Lineage for d3ulee_ (3ule E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735006Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 2735007Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 2735008Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 2735009Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 2735010Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries)
    Uniprot O15145 # 100% sequence identity
  8. 2735013Domain d3ulee_: 3ule E: [201011]
    Other proteins in same PDB: d3ulea1, d3ulea2, d3uleb1, d3ulec_, d3uled1, d3uled2, d3ulef_, d3uleg_
    automated match to d1k8ke_
    complexed with atp, c69, ca

Details for d3ulee_

PDB Entry: 3ule (more details), 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d3ulee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ulee_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

SCOPe Domain Coordinates for d3ulee_:

Click to download the PDB-style file with coordinates for d3ulee_.
(The format of our PDB-style files is described here.)

Timeline for d3ulee_: