Lineage for d3uled2 (3ule D:121-282)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611807Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 2611905Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 2611906Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 2611907Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 2611908Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 2611914Domain d3uled2: 3ule D:121-282 [201010]
    Other proteins in same PDB: d3ulea1, d3ulea2, d3uleb1, d3ulec_, d3ulee_, d3ulef_, d3uleg_
    automated match to d1k8kd2
    complexed with atp, c69, ca

Details for d3uled2

PDB Entry: 3ule (more details), 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d3uled2:

Sequence, based on SEQRES records: (download)

>d3uled2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

Sequence, based on observed residues (ATOM records): (download)

>d3uled2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelktdaavgdnigyitfvlfprhtnasardnti
nlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

SCOPe Domain Coordinates for d3uled2:

Click to download the PDB-style file with coordinates for d3uled2.
(The format of our PDB-style files is described here.)

Timeline for d3uled2: