Lineage for d1ucbh1 (1ucb H:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353053Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (61 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2353077Domain d1ucbh1: 1ucb H:1-113 [20101]
    Other proteins in same PDB: d1ucbh2, d1ucbl1, d1ucbl2
    part of humanized Fab CBR96
    complexed with so4

Details for d1ucbh1

PDB Entry: 1ucb (more details), 2.5 Å

PDB Description: structure of uncomplexed fab compared to complex (1cly, 1clz)
PDB Compounds: (H:) chimeric human/mouse igg fab fragment br96

SCOPe Domain Sequences for d1ucbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsv

SCOPe Domain Coordinates for d1ucbh1:

Click to download the PDB-style file with coordinates for d1ucbh1.
(The format of our PDB-style files is described here.)

Timeline for d1ucbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ucbh2