Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) |
Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries) Uniprot O15144 1-282 # 100% sequence identity |
Domain d3uled1: 3ule D:1-120 [201009] Other proteins in same PDB: d3ulea1, d3ulea2, d3uleb1, d3ulec_, d3ulee_, d3ulef_, d3uleg_ automated match to d1k8kd1 complexed with atp, c69, ca |
PDB Entry: 3ule (more details), 2.5 Å
SCOPe Domain Sequences for d3uled1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uled1 d.198.2.1 (D:1-120) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
Timeline for d3uled1: