SCOPe 2.08: Domain d3uleb1: 3ule B:147-361

Lineage for d3uleb1 (3ule B:147-361)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 2, Arp2 [69530] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
   Uniprot P61160 143-350 # 100% sequence identity

8. Domain d3uleb1: 3ule B:147-361 [201007]
   Other proteins in same PDB: d3ulea1, d3ulea2, d3ulec_, d3uled1, d3uled2, d3ulee_, d3ulef_, d3uleg_
   automated match to d1u2vb1
   complexed with atp, c69, ca

Details for d3uleb1

PDB Entry: 3ule, 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP

PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d3uleb1:

Sequence, based on SEQRES records:

>d3uleb1 c.55.1.1 (B:147-361) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprrkhmvflggavl

Sequence, based on observed residues (ATOM records):

>d3uleb1 c.55.1.1 (B:147-361) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprhmvflggavl

Timeline for d3uleb1:

• d3uleb1 first appeared in SCOPe 2.03
  
• d3uleb1 appears in SCOPe 2.07