Lineage for d3uleb1 (3ule B:147-361)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883667Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 2883668Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 2883671Domain d3uleb1: 3ule B:147-361 [201007]
    Other proteins in same PDB: d3ulea1, d3ulea2, d3ulec_, d3uled1, d3uled2, d3ulee_, d3ulef_, d3uleg_
    automated match to d1u2vb1
    complexed with atp, c69, ca

Details for d3uleb1

PDB Entry: 3ule (more details), 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d3uleb1:

Sequence, based on SEQRES records: (download)

>d3uleb1 c.55.1.1 (B:147-361) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprrkhmvflggavl

Sequence, based on observed residues (ATOM records): (download)

>d3uleb1 c.55.1.1 (B:147-361) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
yaqglltgvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnh
sadfetvrmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealf
qphlinvegvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlyl
ervlkgdveklskfkiriedpprhmvflggavl

SCOPe Domain Coordinates for d3uleb1:

Click to download the PDB-style file with coordinates for d3uleb1.
(The format of our PDB-style files is described here.)

Timeline for d3uleb1: