SCOP 1.59: Domain d1ucbl1: 1ucb L:4-108

Lineage for d1ucbl1 (1ucb L:4-108)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab CBR96 (mouse/human), kappa L chain [48814] (2 PDB entries)

8. Domain d1ucbl1: 1ucb L:4-108 [20100]
   Other proteins in same PDB: d1ucbh2, d1ucbl2

Details for d1ucbl1

PDB Entry: 1ucb, 2.5 Å

PDB Description: structure of uncomplexed fab compared to complex (1cly, 1clz)

SCOP Domain Sequences for d1ucbl1:

Sequence; same for both SEQRES and ATOM records:

>d1ucbl1 b.1.1.1 (L:4-108) Immunoglobulin (variable domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
mtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsgv
pdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

Timeline for d1ucbl1:

• d1ucbl1 first appeared (with stable ids) in SCOP 1.55
  
• d1ucbl1 appears in SCOP 1.57
  
• d1ucbl1 appears in SCOP 1.61
  
• d1ucbl1 appears in the current release, SCOPe 2.08