Class a: All alpha proteins [46456] (289 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries) Uniprot O15145 # 100% sequence identity |
Domain d3ukre_: 3ukr E: [200996] Other proteins in same PDB: d3ukra1, d3ukra2, d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukrf_, d3ukrg_ automated match to d1k8ke_ complexed with ckh |
PDB Entry: 3ukr (more details), 2.48 Å
SCOPe Domain Sequences for d3ukre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ukre_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls
Timeline for d3ukre_: