Lineage for d3ukrb_ (3ukr B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857601Protein Actin-related protein 2, Arp2 [69530] (1 species)
    part of Arp2/3 complex
  7. 1857602Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
    Uniprot P61160 143-350 # 100% sequence identity
  8. 1857604Domain d3ukrb_: 3ukr B: [200993]
    Other proteins in same PDB: d3ukra1, d3ukra2, d3ukrc_, d3ukrd1, d3ukrd2, d3ukre_, d3ukrf_, d3ukrg_
    automated match to d1u2vb1
    complexed with ckh

Details for d3ukrb_

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d3ukrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukrb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
veklskfkiried

SCOPe Domain Coordinates for d3ukrb_:

Click to download the PDB-style file with coordinates for d3ukrb_.
(The format of our PDB-style files is described here.)

Timeline for d3ukrb_: