SCOPe 2.03: Domain d3uipb_: 3uip B:

Lineage for d3uipb_ (3uip B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (9 PDB entries)
   Uniprot Q93068

8. Domain d3uipb_: 3uip B: [200987]
   Other proteins in same PDB: d3uipa_, d3uipc_
   automated match to d1tgzb_

Details for d3uipb_

PDB Entry: 3uip, 2.29 Å

PDB Description: complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii

PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d3uipb_:

Sequence; same for both SEQRES and ATOM records:

>d3uipb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d3uipb_:

• d3uipb_ is new in SCOPe 2.03-stable
  
• d3uipb_ appears in SCOPe 2.04
  
• d3uipb_ appears in the current release, SCOPe 2.08