Lineage for d3uipb_ (3uip B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402285Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1402291Species Human (Homo sapiens) [TaxId:9606] [54242] (9 PDB entries)
    Uniprot Q93068
  8. 1402292Domain d3uipb_: 3uip B: [200987]
    Other proteins in same PDB: d3uipa_, d3uipc_
    automated match to d1tgzb_

Details for d3uipb_

PDB Entry: 3uip (more details), 2.29 Å

PDB Description: complex between human rangap1-sumo1, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d3uipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uipb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d3uipb_:

Click to download the PDB-style file with coordinates for d3uipb_.
(The format of our PDB-style files is described here.)

Timeline for d3uipb_: