Lineage for d3uiob_ (3uio B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1893246Protein automated matches [190118] (9 species)
    not a true protein
  7. 1893271Species Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries)
  8. 1893388Domain d3uiob_: 3uio B: [200986]
    Other proteins in same PDB: d3uioa_, d3uioc_
    automated match to d2io0b_

Details for d3uiob_

PDB Entry: 3uio (more details), 2.6 Å

PDB Description: complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2 containing ir2 motif ii
PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d3uiob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uiob_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqqtgg

SCOPe Domain Coordinates for d3uiob_:

Click to download the PDB-style file with coordinates for d3uiob_.
(The format of our PDB-style files is described here.)

Timeline for d3uiob_: