![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries) |
![]() | Domain d3uinb_: 3uin B: [200985] Other proteins in same PDB: d3uina_, d3uinc_ automated match to d2io0b_ |
PDB Entry: 3uin (more details), 2.6 Å
SCOPe Domain Sequences for d3uinb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uinb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq lemededtidvfqqqtgg
Timeline for d3uinb_: