| Class g: Small proteins [56992] (94 folds) |
| Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) ![]() |
| Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
| Protein automated matches [193184] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries) |
| Domain d3ugda1: 3ugd A:231-280 [200983] Other proteins in same PDB: d3ugda2, d3ugda3, d3ugdb2, d3ugdb3 automated match to d3ugdb_ complexed with edo, po4, zn |
PDB Entry: 3ugd (more details), 1.45 Å
SCOPe Domain Sequences for d3ugda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugda1 g.49.1.1 (A:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvhnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc
Timeline for d3ugda1: