SCOPe 2.06: Domain d3ugda1: 3ugd A:231-280

Lineage for d3ugda1 (3ugd A:231-280)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
   Pfam PF00130

6. Protein automated matches [193184] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)

8. Domain d3ugda1: 3ugd A:231-280 [200983]
   Other proteins in same PDB: d3ugda2, d3ugda3, d3ugdb2, d3ugdb3
   automated match to d3ugdb_
   complexed with edo, po4, zn

Details for d3ugda1

PDB Entry: 3ugd, 1.45 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta

PDB Compounds: (A:) protein kinase c delta type

SCOPe Domain Sequences for d3ugda1:

Sequence; same for both SEQRES and ATOM records:

>d3ugda1 g.49.1.1 (A:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvhnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

Timeline for d3ugda1:

• d3ugda1 first appeared in SCOPe 2.03, called d3ugda_
  
• d3ugda1 was called d3ugda_ in SCOPe 2.05
  
• d3ugda1 appears in SCOPe 2.07
  
• d3ugda1 appears in the current release, SCOPe 2.08