Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab anti-nitrophenol (mouse), lambda L chain [48813] (1 PDB entry) |
Domain d1yuha1: 1yuh A:2-109 [20098] Other proteins in same PDB: d1yuha2, d1yuhb2, d1yuhh2, d1yuhl2 |
PDB Entry: 1yuh (more details), 3 Å
SCOP Domain Sequences for d1yuha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuha1 b.1.1.1 (A:2-109) Immunoglobulin (variable domains of L and H chains) {Fab anti-nitrophenol (mouse), lambda L chain} avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
Timeline for d1yuha1: