Lineage for d1yuha1 (1yuh A:2-109)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102531Species Fab anti-nitrophenol (mouse), lambda L chain [48813] (1 PDB entry)
  8. 102532Domain d1yuha1: 1yuh A:2-109 [20098]
    Other proteins in same PDB: d1yuha2, d1yuhb2, d1yuhh2, d1yuhl2

Details for d1yuha1

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuha1 b.1.1.1 (A:2-109) Immunoglobulin (variable domains of L and H chains) {Fab anti-nitrophenol (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOP Domain Coordinates for d1yuha1:

Click to download the PDB-style file with coordinates for d1yuha1.
(The format of our PDB-style files is described here.)

Timeline for d1yuha1: