Lineage for d3uf9c_ (3uf9 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2834067Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2834068Protein automated matches [190150] (36 species)
    not a true protein
  7. 2834313Species Sulfolobus solfataricus [TaxId:2287] [188418] (16 PDB entries)
  8. 2834370Domain d3uf9c_: 3uf9 C: [200979]
    automated match to d2vc7a_
    complexed with co, fe2, fst, gol

Details for d3uf9c_

PDB Entry: 3uf9 (more details), 2.68 Å

PDB Description: Crystal structure of SsoPox in complex with the phosphotriester fensulfothion
PDB Compounds: (C:) aryldialkylphosphatase

SCOPe Domain Sequences for d3uf9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uf9c_ c.1.9.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

SCOPe Domain Coordinates for d3uf9c_:

Click to download the PDB-style file with coordinates for d3uf9c_.
(The format of our PDB-style files is described here.)

Timeline for d3uf9c_: