Lineage for d3uf2c_ (3uf2 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318797Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2318965Protein automated matches [190501] (4 species)
    not a true protein
  7. 2318966Species Human (Homo sapiens) [TaxId:9606] [187448] (23 PDB entries)
  8. 2318978Domain d3uf2c_: 3uf2 C: [200972]
    automated match to d3uf2i_

Details for d3uf2c_

PDB Entry: 3uf2 (more details), 2.75 Å

PDB Description: Crystal structure of the human Colony-Stimulating Factor 1 (hCSF-1) cytokine
PDB Compounds: (C:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d3uf2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uf2c_ a.26.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedt
mrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfnet
knlldkdwnifskncnnsfaecs

SCOPe Domain Coordinates for d3uf2c_:

Click to download the PDB-style file with coordinates for d3uf2c_.
(The format of our PDB-style files is described here.)

Timeline for d3uf2c_: