Class a: All alpha proteins [46456] (285 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein automated matches [190501] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187448] (13 PDB entries) |
Domain d3uf2b_: 3uf2 B: [200971] automated match to d3uf2i_ |
PDB Entry: 3uf2 (more details), 2.75 Å
SCOPe Domain Sequences for d3uf2b_:
Sequence, based on SEQRES records: (download)
>d3uf2b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedtm rfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfnetk nlldkdwnifskncnnsfaec
>d3uf2b_ a.26.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimedtm rfrdntpnaiaivqlqelslrlkscftkdehdkacvrtfyetplqllekvknvfnetknl ldkdwnifskncnnsfaec
Timeline for d3uf2b_: