SCOPe 2.08: Domain d3uegb_: 3ueg B:

Lineage for d3uegb_ (3ueg B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d3uegb_: 3ueg B: [200968]
   automated match to d3ueec_
   complexed with edo, pg4, zn; mutant

Details for d3uegb_

PDB Entry: 3ueg, 2.8 Å

PDB Description: crystal structure of human survivin k62a mutant

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 5

SCOPe Domain Sequences for d3uegb_:

Sequence; same for both SEQRES and ATOM records:

>d3uegb_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfael
egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef
eetakkvrraieqlaamd

Timeline for d3uegb_:

• d3uegb_ first appeared in SCOPe 2.03
  
• d3uegb_ appears in SCOPe 2.07