Lineage for d3ubcd_ (3ubc D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302854Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2302855Protein automated matches [190590] (26 species)
    not a true protein
  7. 2302946Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)
  8. 2302948Domain d3ubcd_: 3ubc D: [200966]
    automated match to d3ubca_
    complexed with hem, oxy

Details for d3ubcd_

PDB Entry: 3ubc (more details), 1.65 Å

PDB Description: Oxygen-bound hell's gate globin I by LB nanotemplate method
PDB Compounds: (D:) Hemoglobin-like flavoprotein

SCOPe Domain Sequences for d3ubcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubcd_ a.1.1.0 (D:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
idqkekelikeswkriepnkneigllfyanlfkeeptvsvlfqnpissqsrklmqvlgil
vqgidnlegliptlqdlgrrhkqygvvdshyplvgdcllksiqeylgqgfteeakaawtk
vygiaaqvmta

SCOPe Domain Coordinates for d3ubcd_:

Click to download the PDB-style file with coordinates for d3ubcd_.
(The format of our PDB-style files is described here.)

Timeline for d3ubcd_: