Lineage for d3ub0f1 (3ub0 F:1-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697307Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) (S)
  5. 2697319Family a.8.9.0: automated matches [195991] (1 protein)
    not a true family
  6. 2697320Protein automated matches [195992] (1 species)
    not a true protein
  7. 2697321Species Feline infectious peritonitis virus [TaxId:33734] [195993] (1 PDB entry)
  8. 2697325Domain d3ub0f1: 3ub0 F:1-77 [200963]
    Other proteins in same PDB: d3ub0c2, d3ub0f2
    automated match to d3ub0c_
    protein/RNA complex

Details for d3ub0f1

PDB Entry: 3ub0 (more details), 2.6 Å

PDB Description: crystal structure of the nonstructural protein 7 and 8 complex of feline coronavirus
PDB Compounds: (F:) Non-structural protein 7, nsp7

SCOPe Domain Sequences for d3ub0f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ub0f1 a.8.9.0 (F:1-77) automated matches {Feline infectious peritonitis virus [TaxId: 33734]}
skltemkctnvvllgllskmhvesnskewnycvglhneinlcddpdavlekllaliaffl
skhntcdlsdliesyfe

SCOPe Domain Coordinates for d3ub0f1:

Click to download the PDB-style file with coordinates for d3ub0f1.
(The format of our PDB-style files is described here.)

Timeline for d3ub0f1: