Class a: All alpha proteins [46456] (284 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) |
Family a.8.9.0: automated matches [195991] (1 protein) not a true family |
Protein automated matches [195992] (1 species) not a true protein |
Species Feline infectious peritonitis virus [TaxId:33734] [195993] (1 PDB entry) |
Domain d3ub0b_: 3ub0 B: [200961] automated match to d3ub0c_ protein/RNA complex |
PDB Entry: 3ub0 (more details), 2.6 Å
SCOPe Domain Sequences for d3ub0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ub0b_ a.8.9.0 (B:) automated matches {Feline infectious peritonitis virus [TaxId: 33734]} kltemkctnvvllgllskmhvesnskewnycvglhneinlcddpdavlekllaliaffls khntcdlsdliesyfenttilq
Timeline for d3ub0b_: