Lineage for d1yuhl1 (1yuh L:2-109)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288351Species Mouse (Mus musculus) [TaxId:10090] [88541] (25 PDB entries)
  8. 288383Domain d1yuhl1: 1yuh L:2-109 [20096]
    Other proteins in same PDB: d1yuha2, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl2

Details for d1yuhl1

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhl1 b.1.1.1 (L:2-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOP Domain Coordinates for d1yuhl1:

Click to download the PDB-style file with coordinates for d1yuhl1.
(The format of our PDB-style files is described here.)

Timeline for d1yuhl1: