SCOPe 2.05: Domain d3u9fb_: 3u9f B:

Lineage for d3u9fb_ (3u9f B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.1: CAT-like [52778] (3 proteins)
   trimeric enzymes with the active sites being located in between subunits

6. Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species)

7. Species Escherichia coli [TaxId:562] [52780] (9 PDB entries)
   Uniprot P00483

8. Domain d3u9fb_: 3u9f B: [200946]
   automated match to d1q23b_
   complexed with clm

Details for d3u9fb_

PDB Entry: 3u9f, 2.9 Å

PDB Description: Structure of CATI in complex with chloramphenicol

PDB Compounds: (B:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d3u9fb_:

Sequence; same for both SEQRES and ATOM records:

>d3u9fb_ c.43.1.1 (B:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]}
ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
kvlmplaiqvhhavcdgfhvgrmlnelqqycdewq

Timeline for d3u9fb_:

• d3u9fb_ first appeared in SCOPe 2.03
  
• d3u9fb_ appears in SCOPe 2.04
  
• d3u9fb_ appears in SCOPe 2.06
  
• d3u9fb_ appears in the current release, SCOPe 2.08