Lineage for d3u79g_ (3u79 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742239Domain d3u79g_: 3u79 G: [200940]
    automated match to d3u79c_
    complexed with act, mes, zn

Details for d3u79g_

PDB Entry: 3u79 (more details), 1.62 Å

PDB Description: AL-103 Y32F Y96F
PDB Compounds: (G:) Amyloidogenic immunoglobulin light chain protein AL-103 Y32F Y96F, variable domain

SCOPe Domain Sequences for d3u79g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u79g_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stdiqmtqspsslsasvgdrvtitcqasqdisnfliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyycqqyhnlppftfgpgtkleik

SCOPe Domain Coordinates for d3u79g_:

Click to download the PDB-style file with coordinates for d3u79g_.
(The format of our PDB-style files is described here.)

Timeline for d3u79g_: