Lineage for d1vgel1 (1vge L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353753Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 2353761Domain d1vgel1: 1vge L:1-107 [20094]
    Other proteins in same PDB: d1vgeh1, d1vgeh2, d1vgel2
    part of humanized Fab TR1.9

Details for d1vgel1

PDB Entry: 1vge (more details), 2 Å

PDB Description: tr1.9 fab fragment of a human igg1 kappa autoantibody
PDB Compounds: (L:) tr1.9 fab

SCOPe Domain Sequences for d1vgel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgel1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
elvmtqspsslsasvgdrvniacrasqgissalawyqqkpgkaprlliydasnlesgvps
rfsgsgsgtdftltisslqpedfaiyycqqfnsypltfgggtkveik

SCOPe Domain Coordinates for d1vgel1:

Click to download the PDB-style file with coordinates for d1vgel1.
(The format of our PDB-style files is described here.)

Timeline for d1vgel1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgel2