| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab TR1.9 (mouse/human), kappa L chain [48812] (1 PDB entry) |
| Domain d1vgel1: 1vge L:1-107 [20094] Other proteins in same PDB: d1vgeh2, d1vgel2 |
PDB Entry: 1vge (more details), 2 Å
SCOP Domain Sequences for d1vgel1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgel1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab TR1.9 (mouse/human), kappa L chain}
elvmtqspsslsasvgdrvniacrasqgissalawyqqkpgkaprlliydasnlesgvps
rfsgsgsgtdftltisslqpedfaiyycqqfnsypltfgggtkveik
Timeline for d1vgel1: