Lineage for d3u53a_ (3u53 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971606Protein automated matches [190465] (6 species)
    not a true protein
  7. 2971623Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries)
  8. 2971645Domain d3u53a_: 3u53 A: [200932]
    automated match to d3u53c_
    complexed with gol, so4

Details for d3u53a_

PDB Entry: 3u53 (more details), 2.71 Å

PDB Description: Crystal structure of human Ap4A hydrolase
PDB Compounds: (A:) Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

SCOPe Domain Sequences for d3u53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u53a_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
racgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalretqeea
gieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeac
qlaqfkemkaalqeghqflcsiea

SCOPe Domain Coordinates for d3u53a_:

Click to download the PDB-style file with coordinates for d3u53a_.
(The format of our PDB-style files is described here.)

Timeline for d3u53a_: