![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein automated matches [190465] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries) |
![]() | Domain d3u53a_: 3u53 A: [200932] automated match to d3u53c_ complexed with gol, so4 |
PDB Entry: 3u53 (more details), 2.71 Å
SCOPe Domain Sequences for d3u53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u53a_ d.113.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} racgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalretqeea gieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeac qlaqfkemkaalqeghqflcsiea
Timeline for d3u53a_: