| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.184: TorD-like [89154] (1 superfamily) multihelical; bundle |
Superfamily a.184.1: TorD-like [89155] (1 family) ![]() |
| Family a.184.1.1: TorD-like [89156] (5 proteins) Pfam PF06192 |
| Protein automated matches [191026] (2 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries) |
| Domain d3u41d_: 3u41 D: [200926] automated match to d3u41c_ complexed with cl, gol, peg, so4, trs |
PDB Entry: 3u41 (more details), 2.5 Å
SCOPe Domain Sequences for d3u41d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u41d_ a.184.1.1 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mthfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtaf
qtqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemk
qnepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralge
larltlaqwqsqllipvavkplfr
Timeline for d3u41d_: