Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (36 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [189769] (2 PDB entries) |
Domain d3u40e_: 3u40 E: [200923] automated match to d3u40a_ complexed with adn, no3, po4 |
PDB Entry: 3u40 (more details), 2.05 Å
SCOPe Domain Sequences for d3u40e_:
Sequence, based on SEQRES records: (download)
>d3u40e_ c.56.2.0 (E:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl avemeaaalymiaararkqalcmltisdlcygsgekmtaeerrtkftqmmevalslak
>d3u40e_ c.56.2.0 (E:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl avemeaaalymiaararkqalcmltisdlcygsgekmtkftqmmevalslak
Timeline for d3u40e_: