Lineage for d3u15d_ (3u15 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998383Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1998384Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1998547Family a.42.1.0: automated matches [191556] (1 protein)
    not a true family
  6. 1998548Protein automated matches [190960] (1 species)
    not a true protein
  7. 1998549Species Human (Homo sapiens) [TaxId:9606] [188578] (14 PDB entries)
  8. 1998569Domain d3u15d_: 3u15 D: [200919]
    automated match to d3fe7a_
    complexed with 03m, so4

Details for d3u15d_

PDB Entry: 3u15 (more details), 1.8 Å

PDB Description: structure of hdmx with dimer inducing indolyl hydantoin ro-2443
PDB Compounds: (D:) Protein Mdm4

SCOPe Domain Sequences for d3u15d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u15d_ a.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknl

SCOPe Domain Coordinates for d3u15d_:

Click to download the PDB-style file with coordinates for d3u15d_.
(The format of our PDB-style files is described here.)

Timeline for d3u15d_: