Class a: All alpha proteins [46456] (289 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.0: automated matches [191556] (1 protein) not a true family |
Protein automated matches [190960] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188578] (14 PDB entries) |
Domain d3u15d_: 3u15 D: [200919] automated match to d3fe7a_ complexed with 03m, so4 |
PDB Entry: 3u15 (more details), 1.8 Å
SCOPe Domain Sequences for d3u15d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u15d_ a.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell grqsfsvkdpsplydmlrknl
Timeline for d3u15d_: