SCOPe 2.05: Domain d3u15b_: 3u15 B:

Lineage for d3u15b_ (3u15 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.0: automated matches [191556] (1 protein)
   not a true family

6. Protein automated matches [190960] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188578] (10 PDB entries)

8. Domain d3u15b_: 3u15 B: [200918]
   automated match to d3fe7a_
   complexed with 03m, so4

Details for d3u15b_

PDB Entry: 3u15, 1.8 Å

PDB Description: structure of hdmx with dimer inducing indolyl hydantoin ro-2443

PDB Compounds: (B:) Protein Mdm4

SCOPe Domain Sequences for d3u15b_:

Sequence; same for both SEQRES and ATOM records:

>d3u15b_ a.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvrpklpllkilhaagaqgemftvkevmhylgqyimvkqlydqqeqhmvycggdllgell
grqsfsvkdpsplydmlrknlv

Timeline for d3u15b_:

• d3u15b_ first appeared in SCOPe 2.03
  
• d3u15b_ appears in SCOPe 2.04
  
• d3u15b_ appears in SCOPe 2.06
  
• d3u15b_ appears in the current release, SCOPe 2.08