Lineage for d3u0pe1 (3u0p E:7-183)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544622Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2544627Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries)
  8. 2544646Domain d3u0pe1: 3u0p E:7-183 [200915]
    Other proteins in same PDB: d3u0pa2, d3u0pa3, d3u0pb_, d3u0pc2, d3u0pc3, d3u0pd1, d3u0pd2, d3u0pe2, d3u0pf_
    automated match to d1onqa2
    complexed with fuc, gol, hex, lsc, nag, nbu, so4, und

Details for d3u0pe1

PDB Entry: 3u0p (more details), 2.8 Å

PDB Description: crystal structure of human cd1d-lysophosphatidylcholine
PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3u0pe1:

Sequence, based on SEQRES records: (download)

>d3u0pe1 d.19.1.1 (E:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
lfplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwetl
qhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdilsf
qgtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk

Sequence, based on observed residues (ATOM records): (download)

>d3u0pe1 d.19.1.1 (E:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
lfplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhsnnffhvafqgkdilsfqgtsw
eptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d3u0pe1:

Click to download the PDB-style file with coordinates for d3u0pe1.
(The format of our PDB-style files is described here.)

Timeline for d3u0pe1: